Protein trichome birefringence-like

Author: uahm

August undefined, 2024

WebbSUN1 encodes a member of the TRICHOME BIREFRINGEN-LIKE family, AtTBL37 AtTBL37 is highly expressed in fast-growing plant tissues and encodes a Golgi apparatus … WebbSearch BioGRID for SARS-CoV-2 Protein Interactions Download SARS-CoV-2 and Coronavirus-Related Interactions Arabidopsis thaliana (Columbia) TBL25 F6F3.23, F6F3_23, TRICHOME BIREFRINGENCE-LIKE 25, AT1G01430 protein trichome birefringence-like 25 GO Process (0) GO Function (0) GO Component (0) TAIR Entrez Gene RefSeq UniprotKB

Planteome Curate - Gene

WebbWe combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful … Webb15 mars 2024 · The trichome is a general and multi-function plant organ, and trichome birefringence-like ( TBL) genes are related to trichome development. At the genome … pcr buildings

Planteome Curate - Planteome annotation page

Webbgenome browser: aa seq: 440 aa aa seq db search mgiladlcyervishmsediwylnmklhtfeapsgnksvlwnfhkgillaltlilltiip … Webb8 juli 2014 · family of TBL proteins with 46 members (TRICHOME BIREFRINGENCE and TBL1 – TBL45; Bischoff et al., 2010). TBL27 represents a putative XyG O -acetyltra … Webb20 jan. 2015 · Trichome_Birefringence_Like_proteins Home Gene Fams Keys News Docs Cite LINK 2015-01-20 Categories gene family Information. OsTBL1, LOC_Os12g01560, … pcr building services wales

Analysis and review of trichomes in plants - BMC Plant Biology

AT4G11090 details

Webb(RefSeq) protein trichome birefringence-like 19. Organism: lang Lupinus angustifolius (narrow-leaved blue lupine) SSDB: Ortholog Paralog Gene cluster GFIT: Motif: Pfam: PC … WebbProtein trichome birefringence-like 19 OS=Arabidopsis thaliana: 0.02: Archaeplastida: Solyc03g046270.4.1: No alias: Protein trichome birefringence-like 19 OS=Arabidopsis... 0.04: Archaeplastida: Zm00001e009759_P001: No alias: xyloglucan O-acetyltransferase (AXY4) 0.04: Archaeplastida: Zm00001e020949_P001: pcr buffer formulaWebbCultivated soybean (Glycine max (L.)), the world’s most important legume crop, has high-to-moderate salt sensitivity. Being the frontier for sensing and controlling solute transport, membrane proteins could be involved in cell signaling, osmoregulation, and stress-sensing mechanisms, but their roles in abiotic stresses are still largely unknown. … pcr business meaning

"WebbNext-day shipping cDNA ORF clones derived from LOC109233442 protein trichome birefringence-like 3 available at GenScript, starting from $99.00. " - Protein trichome birefringence-like

Protein trichome birefringence-like

WebbProtein trichome birefringence-like 30 OS=Arabidopsis thaliana GN=TBL30 PE=2 SV=1: trembl. ID: B9SQN5: description: Putative uncharacterized protein OS=Ricinus communis … Webb1 okt. 2024 · The TRICHOME BIREFRINGENCE-LIKE (TBL) family is an important gene family engaged in the O -acetylation of cell wall polysaccharides. There have been a few …

Did you know?

WebbHere, we report on the isolation and characterization of two trichome birefringence-like (tbl) mutants in rice (Oryza sativa), which are affected in xylan O-acetylation. ostbl1 and … WebbLOC104770267 protein trichome birefringence-like 11 [ (false flax)] Gene ID: 104770267, updated on 4-Dec-2024. Summary Other designations. protein trichome ...

Webb28 juni 2011 · Protein Protein trichome birefringence-like 33 Gene TBL33 Status UniProtKB reviewed (Swiss-Prot) Organism Arabidopsis thaliana (Mouse-ear cress) … Webb5 juni 2024 · As functional proteins, dehydrins are found in many maturing seeds and vegetable tissues under adverse environmental conditions. However, the regulation of …

WebbTitle: Genome-wide characterization of trichome birefringence-like genes provides insights into fiber yield improvement: Authors : Li, Z., Shi, Y., Xiao, X., Song, J ... Webb18 nov. 2016 · Here, we report on the isolation and characterization of two trichome birefringence-like (tbl) mutants in rice (Oryza sativa), which are affected in xylan O …

Webb1 feb. 2024 · SAD2 (SENSITIVE TO ABA AND DROUGHT 2), an importin β-like protein, regulates trichome initiation through mediating GL3 function. In sad2 mutants, the …

WebbProtein trichome birefringence-like 38 OS=Arabidopsis thaliana: ... Protein trichome birefringence OS=Arabidopsis thaliana... 0.02: Archaeplastida: Solyc03g096030.3.1: No … pcr buffer成分WebbF6F3.23, F6F3_23, TRICHOME BIREFRINGENCE-LIKE 25, AT1G01430. protein trichome birefringence-like 25. GO Process (0) GO Function (0) GO Component (0) TAIR Entrez … pcr buffertWebb18 nov. 2016 · Acetylation), Trichome Birefringence-Like (TBL) proteins, and A XY9 (Altered 107 Xyloglucan 9) are involved in the polymer O -acetylation. RWAs consist of … pcr building certificateWebbprotein_coding. Species: Arabidopsis thaliana. Synonyms: TRICHOME BIREFRINGENCE-LIKE 34 [Source:NCBI gene (formerly Entrezgene);Acc ... Summary: Description: … pcr bullish or bearishWebb1 mars 2002 · Protein Protein trichome birefringence-like 38 Gene TBL38 Status UniProtKB reviewed (Swiss-Prot) Organism Arabidopsis thaliana (Mouse-ear cress) … pcr business definitionWebbTissue specificity. Note: SPM calculations for this profile are done using the maximum value. pcr building services narranderaWebb4 nov. 2024 · trichome birefringence-like protein (DUF828) RefSeq status REVIEWED Organism Arabidopsis thaliana (ecotype: Columbia) Lineage Eukaryota; Viridiplantae; … pcr business acronym